MYCN Recombinant monoclonal antibody

MYCN Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 84886-3-RR
Clone No.242406D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

242406D8, bHLHe37, MODED, N myc, N myc proto oncogene protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inIMR-32 cells, human placenta tissue
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84886-3-RR targets MYCN in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27224

Product name: Recombinant human MYCN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 289-464 aa of BC002712

Sequence: SNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC

Predict reactive species
Full Name v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)
Calculated Molecular Weight 50 kDa
Observed Molecular Weight~65 kDa
GenBank Accession NumberBC002712
Gene Symbol MYCN
Gene ID (NCBI) 4613
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04198
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYCN, also named as BHLHE37 and NMYC, is a transcription factor. It is primarily expressed in normal developing embryos and is thought to be critical in brain and other neural development. It is often amplified in human neuroblastomas. IR34A can suppress MYCN expression, it suggest MYCN has a role in cell growth. The expression of the MCYN is upregulated in a variety of human tumors, most frequently neuroblastoma, where the level of expression appears to increase as the tumor progresses. The calculated molecuar weight of MYCN is 50 kDa, but Phosphorylated MYCN is about 65-70 kDa. MYCN exsits two isoforms and MV of isoform is respectively 65 kDa and 45 kDa. (PMID: 19615087 )

Protocols

Product Specific Protocols
FC protocol for MYCN antibody 84886-3-RRDownload protocol
WB protocol for MYCN antibody 84886-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...