MYCN Recombinant monoclonal antibody, PBS Only (Capture)

MYCN Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 84886-3-PBS
Clone No.242406D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

242406D8, bHLHe37, MODED, N myc, N myc proto oncogene protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84886-3-PBS targets MYCN as part of a matched antibody pair:

MP01659-2: 84886-3-PBS capture and 84886-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27224

Product name: Recombinant human MYCN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 289-464 aa of BC002712

Sequence: SNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC

Predict reactive species
Full Name v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)
Calculated Molecular Weight 50 kDa
Observed Molecular Weight~65 kDa
GenBank Accession NumberBC002712
Gene Symbol MYCN
Gene ID (NCBI) 4613
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04198
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MYCN, also named as BHLHE37 and NMYC, is a transcription factor. It is primarily expressed in normal developing embryos and is thought to be critical in brain and other neural development. It is often amplified in human neuroblastomas. IR34A can suppress MYCN expression, it suggest MYCN has a role in cell growth. The expression of the MCYN is upregulated in a variety of human tumors, most frequently neuroblastoma, where the level of expression appears to increase as the tumor progresses. The calculated molecuar weight of MYCN is 50 kDa, but Phosphorylated MYCN is about 65-70 kDa. MYCN exsits two isoforms and MV of isoform is respectively 65 kDa and 45 kDa. (PMID: 19615087 )

Loading...
||
New chat Able
正在加载,请稍候...