• Featured Product
  • KD/KO Validated

GS28 Recombinant monoclonal antibody, PBS Only (Capture)

GS28 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84971-3-PBS
Clone No.242552G12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

242552G12, 28 kDa cis-Golgi SNARE p28, 28 kDa Golgi SNARE protein, Golgi SNAP receptor complex member 1, GOS-28

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84971-3-PBS targets GS28 as part of a matched antibody pair:

MP01719-2: 84971-3-PBS capture and 84971-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9021

Product name: Recombinant human GS28 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-117 aa of BC012620

Sequence: MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQV

Predict reactive species
Full Name golgi SNAP receptor complex member 1
Calculated Molecular Weight28.6 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC012620
Gene Symbol GS28
Gene ID (NCBI) 9527
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95249
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GS28, also known as GOSR1, is a 28-kDa Golgi SNARE protein that participates in ER-Golgi and intra-Golgi transport. GS28 is considered to be a core component of the Golgi SNARE complex. (PMID: 8638159)

Loading...
||
New chat Able
正在加载,请稍候...