• All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
×
×
Host
0
Species Reactivity
0
Species Reactivity
0
Conjugate
0
Conjugate
0
Compatible Species
0
Conjugate
0
Use Able AI chat for product recommendations
Filter:
  • Western Blot (WB) analysis of various lysates using Foxp3 Recombinant antibody (85128-6-RR)

    WB analysis using 85128-6-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 85128-6-RR (Foxp3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of various lysates using Foxp3 Recombinant monoclonal antibody (85128-6-RR)

    WB analysis using 85128-6-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 85128-6-RR (Foxp3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  • Immunohistochemistry (IHC) staining of mouse spleen tissue using Foxp3 Recombinant antibody (85128-6-RR)

    IHC staining of mouse spleen using 85128-6-RR

    Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85128-6-RR (Foxp3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human tonsillitis tissue using Foxp3 Recombinant antibody (85128-6-RR)

    IHC staining of human tonsillitis using 85128-6-RR

    Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 85128-6-RR (Foxp3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of mouse spleen tissue using Foxp3 Recombinant antibody (85128-6-RR)

    IHC staining of mouse spleen using 85128-6-RR

    Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85128-6-RR (Foxp3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of mouse spleen tissue using Foxp3 Recombinant monoclonal antibody (85128-6-RR)

    IHC staining of mouse spleen using 85128-6-RR

    Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85128-6-RR (Foxp3 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of mouse spleen tissue using Foxp3 Recombinant monoclonal antibody (85128-6-RR)

    IHC staining of mouse spleen using 85128-6-RR

    Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85128-6-RR (Foxp3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of mouse spleen tissue using Foxp3 Recombinant antibody (85128-6-RR)

    IF Staining of mouse spleen using 85128-6-RR

    Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using Foxp3 antibody (85128-6-RR, Clone: 242853G11 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of mouse spleen tissue using Foxp3 Recombinant antibody (85128-6-RR)

    IF Staining of mouse spleen using 85128-6-RR

    Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using Foxp3 antibody (85128-6-RR, Clone: 242853G11 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Foxp3 Recombinant monoclonal antibody

Foxp3 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 85128-6-RR
Clone No.242853G11

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

forkhead box P3, Forkhead box protein P3 41 kDa form, Forkhead box protein P3, C-terminally processed, JM2, scurfin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Tested Applications

Positive WB detected inmouse thymus tissue, MJ cells, rat thymus tissue, mouse spleen tissue, rat spleen tissue
Positive IHC detected inmouse spleen tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse spleen tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85128-6-RR targets Foxp3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg4360

Product name: Recombinant Mouse Foxp3 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 10007378 of

Sequence: YPLLANGVCKWPGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPS

Predict reactive species
Full Name forkhead box P3
Observed Molecular Weight 45 kDa
Gene Symbol Foxp3
Gene ID (NCBI) 20371
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99JB6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FOXP3, also named as IPEX, JM2 and Scurfin, is a transcription factor. FOXP3 plays a critical role in the control of immune response. Defects in FOXP3 are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) which also known as X-linked autoimmunity-immunodeficiency syndrome.

Protocols

Product Specific Protocols
IF protocol for Foxp3 antibody 85128-6-RRDownload protocol
IHC protocol for Foxp3 antibody 85128-6-RRDownload protocol
WB protocol for Foxp3 antibody 85128-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
||
New chat Able
正在加载，请稍候...