Mouse Foxp3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85128-6-RR (same clone as 85128-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85128-6-RR (Foxp3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85128-6-PBS in a different storage buffer formulation.

• 

  WB analysis using 85128-6-RR (same clone as 85128-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85128-6-RR (Foxp3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85128-6-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85128-6-RR (same clone as 85128-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85128-6-RR (Foxp3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85128-6-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 85128-6-RR (same clone as 85128-6-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 85128-6-RR (Foxp3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85128-6-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85128-6-RR (same clone as 85128-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85128-6-RR (Foxp3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85128-6-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85128-6-RR (same clone as 85128-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85128-6-RR (Foxp3 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85128-6-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85128-6-RR (same clone as 85128-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85128-6-RR (Foxp3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85128-6-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse spleen using 85128-6-RR (same clone as 85128-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using Foxp3 antibody (85128-6-RR, Clone: 242853G11 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85128-6-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse spleen using 85128-6-RR (same clone as 85128-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using Foxp3 antibody (85128-6-RR, Clone: 242853G11 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85128-6-PBS in a different storage buffer formulation.

Foxp3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 85128-6-PBS

Clone No.242853G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

forkhead box P3, Forkhead box protein P3 41 kDa form, Forkhead box protein P3, C-terminally processed, JM2, scurfin

---

Product Information

85128-6-PBS targets Foxp3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4360

  Product name: Recombinant Mouse Foxp3 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 10007378 of

  Sequence: YPLLANGVCKWPGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPS

• Full Name: forkhead box P3
• Observed Molecular Weight: 45 kDa
• Gene Symbol: Foxp3
• Gene ID (NCBI): 20371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99JB6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FOXP3, also named as IPEX, JM2 and Scurfin, is a transcription factor. FOXP3 plays a critical role in the control of immune response. Defects in FOXP3 are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) which also known as X-linked autoimmunity-immunodeficiency syndrome.