• All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
×
×
Host
0
Species Reactivity
0
Species Reactivity
0
Conjugate
0
Conjugate
0
Compatible Species
0
Conjugate
0
Use Able AI chat for product recommendations
Filter:
  • Western Blot (WB) analysis of various lysates using DNAJC7 Recombinant antibody (85157-4-RR)

    WB analysis using 85157-4-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 85157-4-RR (DNAJC7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  • Immunohistochemistry (IHC) staining of mouse brain tissue using DNAJC7 Recombinant antibody (85157-4-RR)

    IHC staining of mouse brain using 85157-4-RR

    Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85157-4-RR (DNAJC7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using DNAJC7 Recombinant antibody (85157-4-RR)

    IF Staining of HepG2 using 85157-4-RR

    Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DNAJC7 antibody (85157-4-RR, Clone: 242875B3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  • Flow cytometry (FC) experiment of HeLa cells using DNAJC7 Recombinant antibody (85157-4-RR)

    FC experiment of HeLa using 85157-4-RR

    1x10^6 HeLa cells were intracellularly stained with 0.25 ug DNAJC7 Recombinant antibody (85157-4-RR, Clone:242875B3) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  • Affinity and Kinetic Characterization of 85157-4-RR

    Affinity and Kinetic Characterization of 85157-4-RR

    Biolayer interferometry (BLl) kinetic assays of 85157-4-RR against Human DNAJC7 were performed. The affinity constant is 0.767 nM.

DNAJC7 Recombinant monoclonal antibody

DNAJC7 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 85157-4-RR
Clone No.242875B3

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

242875B3, CCRP, DANJC7, DNAJC 7, TPR2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, A549 cells, HEK-293 cells, Jurkat cells, mouse testis tissue, rat testis tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85157-4-RR targets DNAJC7 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1572

Product name: Recombinant human DNAJC7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 145-494 aa of BC011837

Sequence: YEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG

Predict reactive species
Full Name DnaJ (Hsp40) homolog, subfamily C, member 7
Calculated Molecular Weight 56 kDa
Observed Molecular Weight56 kDa
GenBank Accession NumberBC011837
Gene Symbol DNAJC7
Gene ID (NCBI) 7266
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99615
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DnaJC7, otherwise referred to as Tpr2 or CCRP, is a conserved, type of J protein that is highly expressed within the brain. DnaJC7 has been found to modulate the flow of substrates from Hsp70 to Hsp90, providing a control mechanism in proteins such as glucocorticoids and progesterone receptor.

Protocols

Product Specific Protocols
IF protocol for DNAJC7 antibody 85157-4-RRDownload protocol
IHC protocol for DNAJC7 antibody 85157-4-RRDownload protocol
WB protocol for DNAJC7 antibody 85157-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
||
New chat Able
正在加载，请稍候...