Mouse Cd44 Recombinant monoclonal antibody, PBS Only (Detector)

Cd44 Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85163-1-PBS
Clone No.242666C2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

CD44 antigen, CDw44, CSPG8, ECMR III, ECMR-III

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85163-1-PBS targets Cd44 as part of a matched antibody pair:

MP01873-1: 85163-2-PBS capture and 85163-1-PBS detection (validated in Cytometric bead array)

MP01873-2: 85163-3-PBS capture and 85163-1-PBS detection (validated in Cytometric bead array)

MP01873-3: 85163-4-PBS capture and 85163-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3159

Product name: Recombinant Mouse CD44 protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 25-224 aa of NM_009851.2

Sequence: QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLAT

Predict reactive species
Full Name CD44 antigen
Calculated Molecular Weight86 kDa
GenBank Accession NumberNM_009851.2
Gene Symbol Cd44
Gene ID (NCBI) 12505
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDNP_033981
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...