Mouse IL-4 Recombinant monoclonal antibody, PBS Only (Capture)

IL-4 antibodies are versatile tools for investigating IL-4’s roles in immunity, allergy, autoimmunity, and cancer, supporting a wide range of molecular, cellular, and functional assays. Proteintech has an extensive range of validated IL-4 antibodies antibodies for WB, IHC, IF-P, ELISA and more.
Cat No. 85179-7-PBS
Clone No.242736G7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Indirect ELISA, Sample test

Il 4, Il4, interleukin 4

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85179-7-PBS targets IL-4 as part of a matched antibody pair:

MP01896-3: 85179-7-PBS capture and 85179-6-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3750

Product name: Recombinant Mouse IL-4 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 21-140 aa of BC027514

Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Predict reactive species
Full Name interleukin 4
GenBank Accession NumberBC027514
Gene Symbol IL-4
Gene ID (NCBI) 16189
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07750
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...