EPS8 Recombinant monoclonal antibody

EPS8 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 85184-5-RR
Clone No.242835G12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Epidermal growth factor receptor kinase substrate 8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, C2C12 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85184-5-RR targets EPS8 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3121

Product name: Recombinant human EPS8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 13-267 aa of BC030010

Sequence: GMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARID

Predict reactive species
Full Name epidermal growth factor receptor pathway substrate 8
Calculated Molecular Weight 822 aa, 92 kDa
Observed Molecular Weight 97 kDa
GenBank Accession NumberBC030010
Gene Symbol EPS8
Gene ID (NCBI) 2059
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ12929
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Epidermal growth factor receptor Pathway Substrate 8 (EPS8) is a crucial regulator of the actin cytoskeleton dynamics accompanying cell motility and invasion. This protein contains one PH domain and one SH3 domain leading to its binding activity with multiple cellular targets. EPS8 can function as a unique actin capping protein specifically required for dendritic cell migration and plays roles in the regulation of axonal filopodia in neuronal development and synapse formation. The EPS8 gene may contribute to the development of a subset of colorectal cancers and could have applications in diagnosis and treatment.

Protocols

Product Specific Protocols
IHC protocol for EPS8 antibody 85184-5-RRDownload protocol
WB protocol for EPS8 antibody 85184-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...