EPS8 Recombinant monoclonal antibody, PBS Only

EPS8 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 85184-5-PBS
Clone No.242835G12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Epidermal growth factor receptor kinase substrate 8

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85184-5-PBS targets EPS8 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3121

Product name: Recombinant human EPS8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 13-267 aa of BC030010

Sequence: GMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARID

Predict reactive species
Full Name epidermal growth factor receptor pathway substrate 8
Calculated Molecular Weight 822 aa, 92 kDa
Observed Molecular Weight 97 kDa
GenBank Accession NumberBC030010
Gene Symbol EPS8
Gene ID (NCBI) 2059
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ12929
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Epidermal growth factor receptor Pathway Substrate 8 (EPS8) is a crucial regulator of the actin cytoskeleton dynamics accompanying cell motility and invasion. This protein contains one PH domain and one SH3 domain leading to its binding activity with multiple cellular targets. EPS8 can function as a unique actin capping protein specifically required for dendritic cell migration and plays roles in the regulation of axonal filopodia in neuronal development and synapse formation. The EPS8 gene may contribute to the development of a subset of colorectal cancers and could have applications in diagnosis and treatment.

Loading...
||
New chat Able
正在加载,请稍候...