Tested Applications
| Positive WB detected in | TNF alpha, PMA and BSA treated A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85606-5-RR targets CXCL5 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2939 Product name: Recombinant Human CXCL5 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 37-114 aa of NM_002994.4 Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 5 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 10-12 kDa |
| GenBank Accession Number | NM_002994.4 |
| Gene Symbol | CXCL5 |
| Gene ID (NCBI) | 6374 |
| RRID | AB_3744234 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P42830 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chemokines are a class of pro-inflammatory cytokines that can recruit and activate chemotactic cells. CXCL5 is a member of the chemokine family binding CXCR2, a G-protein coupled receptor. CXCL5 is a chemokine that promotes tumor formation by triggering the migration of immune cells to tumors and promotes immmuno-suppressive characteristics of the tumor microenvironment. CXCL5 can also promote tumor cell metastasis and recruit vascular endothelial cells for angiogenesis.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CXCL5 antibody 85606-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Ecotoxicol Environ Saf Cadmium exposure upregulates TXNIP and aggravates calcium oxalate kidney stone formation by promoting cell-crystal adhesion, apoptosis and macrophage M1 polarization.
|

