NUP133 Recombinant monoclonal antibody, PBS Only (Detector)

NUP133 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85609-1-PBS
Clone No.243092B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

133 kDa nucleoporin, hNUP133, nucleoporin 133kDa, Nucleoporin Nup133

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85609-1-PBS targets NUP133 as part of a matched antibody pair:

MP01982-2: 85609-2-PBS capture and 85609-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3100

Product name: Recombinant human NUP133 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 857-1156 aa of BC020107

Sequence: LWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDFLFRWYLEKGKRGKLLSQPISQHGQLANFLQAHEHLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDEEEDININDLKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQI

Predict reactive species
Full Name nucleoporin 133kDa
Calculated Molecular Weight 1156 aa, 129 kDa
Observed Molecular Weight 129 kDa
GenBank Accession NumberBC020107
Gene Symbol NUP133
Gene ID (NCBI) 55746
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8WUM0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Nuclear pore complex protein Nup133 is a protein that in humans is encoded by the NUP133 gene. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells.

Loading...
||
New chat Able
正在加载,请稍候...