Use Able AI chat for product recommendations

ST3GAL2 Recombinant monoclonal antibody, PBS Only (Detector)

ST3GAL2 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 85634-2-PBS
Clone No.253479G5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Alpha 2,3-ST 2, Beta-galactoside alpha-2,3-sialyltransferase 2, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2, EC:2.4.3.2, EC:2.4.3.4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85634-2-PBS targets ST3GAL2 as part of a matched antibody pair:

MP03241-1: 85634-3-PBS capture and 85634-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4528

Product name: Recombinant human ST3GAL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-210 aa of BC036777

Sequence: SHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPA

Predict reactive species
Full Name ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Calculated Molecular Weight 350 aa, 40 kDa
Observed Molecular Weight40-43 kDa
GenBank Accession NumberBC036777
Gene Symbol ST3GAL2
Gene ID (NCBI) 6483
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16842
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Beta-galactoside alpha-2,3-sialyltransferase 2 (ST3GAL2) is a sialyltransferase (ST) that transfers sialic acid from the activated donor CMP-sialic acid to the glycan terminus of a glycolipid or glycoprotein. ST3GAL2 contains two putative N-glycosylation sites (Asn92 and Asn211), which are mainly responsible for GD1a and GT1b ganglioside biosynthesis in the brain. ST3GAL2 belongs to the sialyltransferase family, which mediates the terminal modification of glycoproteins and glycolipids. ST3GAL2 has been found to play a role in obesity, aging, and malignant diseases (PMID: 34319453).

Loading...
||
New chat

Able

正在加载,请稍候...