CDO1 Recombinant monoclonal antibody

CDO1 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85636-2-RR
Clone No.250039D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

CDO, CDO I, CDO-I, Cysteine dioxygenase type 1, Cysteine dioxygenase type I

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat liver tissue, mouse liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85636-2-RR targets CDO1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3294

Product name: Recombinant human CDO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of BC024241

Sequence: MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN

Predict reactive species
Full Name cysteine dioxygenase, type I
Calculated Molecular Weight 200 aa, 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC024241
Gene Symbol CDO1
Gene ID (NCBI) 1036
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16878
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDO1(cysteine dioxygenase type 1) is also named as CDO and belongs to the cysteine dioxygenase family. It is an enzyme that adds molecular oxygen to the sulfur of cysteine, converting the thiol to a sulfinic acid known as cysteinesulfinic acid (3-sulfinoalanine) and CDO1 is one of the most highly regulated metabolic enzymes responding to diet(PMID:19011731). The expression of CDO can significantly decrease the level of intracellular cysteine and this reduction is also associated with a decrease in total glutathione levels(PMID:17327371). Cysteine dioxygenase (CDO) plays a critical role in the regulation of cellular cysteine concentration andmultiple forms of CDO (23 kDa, 25 kDa, and 68 kDa) have been claimed based upon separation and detection using SDS-PAGE/western blotting(PMID: 14752623).

Protocols

Product Specific Protocols
WB protocol for CDO1 antibody 85636-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...