CDO1 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

• 

  WB analysis using 85636-2-RR (same clone as 85636-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85636-2-RR (CDO1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85636-2-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 85636-2-RR (same clone as 85636-2-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 85636-2-RR (CDO1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85636-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP02053-1

  Cytometric bead array standard curve of MP02053-1, CDO1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85636-3-PBS. Detection antibody: 85636-2-PBS. Standard: Ag3294. Range: 0.781-100 ng/mL.

• 

  Cytometric bead array standard curve of MP02053-2

  Cytometric bead array standard curve of MP02053-2, CDO1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85636-2-PBS. Detection antibody: 85636-1-PBS. Standard: Ag3294. Range: 0.781-100 ng/mL.

CDO1 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 85636-2-PBS

Clone No.250039D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

CDO, CDO I, CDO-I, Cysteine dioxygenase type 1, Cysteine dioxygenase type I

---

Product Information

85636-2-PBS targets CDO1 as part of a matched antibody pair:

MP02053-1: 85636-3-PBS capture and 85636-2-PBS detection (validated in Cytometric bead array)

MP02053-2: 85636-2-PBS capture and 85636-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3294

  Product name: Recombinant human CDO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC024241

  Sequence: MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN

• Full Name: cysteine dioxygenase, type I
• Calculated Molecular Weight: 200 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC024241
• Gene Symbol: CDO1
• Gene ID (NCBI): 1036
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16878
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDO1(cysteine dioxygenase type 1) is also named as CDO and belongs to the cysteine dioxygenase family. It is an enzyme that adds molecular oxygen to the sulfur of cysteine, converting the thiol to a sulfinic acid known as cysteinesulfinic acid (3-sulfinoalanine) and CDO1 is one of the most highly regulated metabolic enzymes responding to diet(PMID:19011731). The expression of CDO can significantly decrease the level of intracellular cysteine and this reduction is also associated with a decrease in total glutathione levels(PMID:17327371). Cysteine dioxygenase (CDO) plays a critical role in the regulation of cellular cysteine concentration andmultiple forms of CDO (23 kDa, 25 kDa, and 68 kDa) have been claimed based upon separation and detection using SDS-PAGE/western blotting(PMID: 14752623).