KIF23 Recombinant monoclonal antibody, PBS Only (Capture)

KIF23 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 85675-5-PBS
Clone No.243084E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Cytometric bead array, Indirect ELISA

243084E3, KNSL5, MKLP1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85675-5-PBS targets KIF23 as part of a matched antibody pair:

MP02031-1: 85675-5-PBS capture and 85675-4-PBS detection (validated in Cytometric bead array)

MP02031-2: 85675-5-PBS capture and 85675-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29346

Product name: Recombinant human KIF23 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 486-683 aa of NM_138555

Sequence: LDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSV

Predict reactive species
Full Name kinesin family member 23
Calculated Molecular Weight 110 kDa
GenBank Accession NumberNM_138555
Gene Symbol KIF23
Gene ID (NCBI) 9493
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ02241
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

KIF23, also known as KNSL5 and MKLP1, is a member of the kinesin-like protein family. It plays a crucial role in cytokinesis, the final stage of cell division. It is involved in the formation of the central spindle, which is essential for the proper separation of the cytoplasm and the formation of the cleavage furrow. KIF23 is also involved in the organization and transport of intracellular vesicles and organelles. Mutations in KIF23 have been associated with congenital dyserythropoietic anemia type III(PMID: 23570799).

Loading...
||
New chat Able
正在加载,请稍候...