DARS2 Recombinant monoclonal antibody

DARS2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 85691-2-RR
Clone No.243050E5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Aspartate  tRNA ligase, Aspartate--tRNA ligase, mitochondrial, Aspartyl-tRNA synthetase, AspRS, EC:6.1.1.12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, Jurkat cells, LNCaP cells, A549 cells, HepG2 cells, NCI-H1299 cells
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85691-2-RR targets DARS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4809

Product name: Recombinant human DARS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 296-645 aa of BC045173

Sequence: LIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH

Predict reactive species
Full Name aspartyl-tRNA synthetase 2, mitochondrial
Calculated Molecular Weight 645 aa, 74 kDa
Observed Molecular Weight 66-74 kDa
GenBank Accession NumberBC045173
Gene Symbol DARS2
Gene ID (NCBI) 55157
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6PI48
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DARS2 is also named as AspRS (aspartyl-tRNA synthetase) and belongs to the class-II aminoacyl-tRNA synthetase family. The deduced 645-amino acid protein has a 47-amino acid mitochondrial targeting signal, resulting in a mature protein of 598 amino acids. DARS2 contains conserved residues involved in ATP binding, tRNA binding, and aspartic acid recognition, as well as catalytic site motifs characteristic of amino acid tRNA synthetases. It is a dimeric proteins(PMID:19443655). Rat aspartyl-tRNA synthetase has a N-terminal polypeptide extension of about 40 amino acid residues which can be removed without impairing its catalytic activity(PMID:9030747). This protein has different molecular mass(55 kDa, 50 kDa,66 kDa ) according to the publications(PMID:11306575; 19443655;15299749).

Protocols

Product Specific Protocols
IF protocol for DARS2 antibody 85691-2-RRDownload protocol
WB protocol for DARS2 antibody 85691-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...