DARS2 Recombinant monoclonal antibody, PBS Only (Detector)

DARS2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 85691-2-PBS
Clone No.243050E5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Aspartate  tRNA ligase, Aspartate--tRNA ligase, mitochondrial, Aspartyl-tRNA synthetase, AspRS, EC:6.1.1.12

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85691-2-PBS targets DARS2 as part of a matched antibody pair:

MP02026-2: 85691-3-PBS capture and 85691-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4809

Product name: Recombinant human DARS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 296-645 aa of BC045173

Sequence: LIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH

Predict reactive species
Full Name aspartyl-tRNA synthetase 2, mitochondrial
Calculated Molecular Weight 645 aa, 74 kDa
Observed Molecular Weight 66-74 kDa
GenBank Accession NumberBC045173
Gene Symbol DARS2
Gene ID (NCBI) 55157
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6PI48
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DARS2 is also named as AspRS (aspartyl-tRNA synthetase) and belongs to the class-II aminoacyl-tRNA synthetase family. The deduced 645-amino acid protein has a 47-amino acid mitochondrial targeting signal, resulting in a mature protein of 598 amino acids. DARS2 contains conserved residues involved in ATP binding, tRNA binding, and aspartic acid recognition, as well as catalytic site motifs characteristic of amino acid tRNA synthetases. It is a dimeric proteins(PMID:19443655). Rat aspartyl-tRNA synthetase has a N-terminal polypeptide extension of about 40 amino acid residues which can be removed without impairing its catalytic activity(PMID:9030747). This protein has different molecular mass(55 kDa, 50 kDa,66 kDa ) according to the publications(PMID:11306575; 19443655;15299749).

Loading...
||
New chat Able
正在加载,请稍候...