Mouse CD74 Recombinant monoclonal antibody, PBS Only (Capture)

CD74 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85802-1-PBS
Clone No.250109F2

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Class-II-associated invariant chain peptide, CLIP, H-2 class II histocompatibility antigen gamma chain, Ia antigen-associated invariant chain, Ii

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85802-1-PBS targets CD74 as part of a matched antibody pair:

MP02137-1: 85802-1-PBS capture and 85802-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2716

Product name: Recombinant Mouse Cd74 protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 56-279 aa of NM_001042605.1

Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

Predict reactive species
Full Name CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)
Calculated Molecular Weight32 kDa
Observed Molecular Weight38 kDa
GenBank Accession NumberNM_001042605.1
Gene Symbol Cd74
Gene ID (NCBI) 16149
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04441-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165; PMID: 36712241).

Loading...
||
New chat Able
正在加载,请稍候...