ACTN2 Recombinant monoclonal antibody, PBS Only (Capture)

ACTN2 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 85857-4-PBS
Clone No.250229F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Actinin alpha 2, actinin, alpha 2, ACTN 2, Alpha actinin 2, Alpha-actinin skeletal muscle isoform 2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85857-4-PBS targets ACTN2 as part of a matched antibody pair:

MP02153-1: 85857-4-PBS capture and 85857-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5459

Product name: Recombinant human ACTN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-301 aa of BC051770

Sequence: MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTI

Predict reactive species
Full Name actinin, alpha 2
Calculated Molecular Weight 104 kDa
Observed Molecular Weight103 kDa
GenBank Accession NumberBC051770
Gene Symbol ACTN2
Gene ID (NCBI) 88
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35609
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Alpha actinin 2 (ACTN2) belongs to the alpha-actinin family and is expressed in both skeletal and cardiac muscles, and functions to anchor myofibrillar actin thin filaments and titin to Z-discs (PMID: 30701273). ACTN2 is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. Mutations in ACTN2 are associated with hypertrophic cardiomyopathy, as well as dilated cardiomyopathy and endocardial fibroelastosis (PMID: 20022194, 14567970).

Loading...
||
New chat Able
正在加载,请稍候...