ACTN2 Recombinant monoclonal antibody

ACTN2 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85857-4-RR
Clone No.250229F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Actinin alpha 2, actinin, alpha 2, ACTN 2, Alpha actinin 2, Alpha-actinin skeletal muscle isoform 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, A549 cells, HeLa cells, NIH/3T3 cells, C6 cells
Positive IHC detected inmouse heart tissue, mouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inH9C2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85857-4-RR targets ACTN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5459

Product name: Recombinant human ACTN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-301 aa of BC051770

Sequence: MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTI

Predict reactive species
Full Name actinin, alpha 2
Calculated Molecular Weight 104 kDa
Observed Molecular Weight103 kDa
GenBank Accession NumberBC051770
Gene Symbol ACTN2
Gene ID (NCBI) 88
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35609
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha actinin 2 (ACTN2) belongs to the alpha-actinin family and is expressed in both skeletal and cardiac muscles, and functions to anchor myofibrillar actin thin filaments and titin to Z-discs (PMID: 30701273). ACTN2 is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. Mutations in ACTN2 are associated with hypertrophic cardiomyopathy, as well as dilated cardiomyopathy and endocardial fibroelastosis (PMID: 20022194, 14567970).

Protocols

Product Specific Protocols
IF protocol for ACTN2 antibody 85857-4-RRDownload protocol
IHC protocol for ACTN2 antibody 85857-4-RRDownload protocol
WB protocol for ACTN2 antibody 85857-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...