SYNJ2BP Recombinant monoclonal antibody

SYNJ2BP Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 85870-4-RR
Clone No.250205D7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, ELISA

ARIP2, OMP25, Synaptojanin-2-binding protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, rat kidney tissue, SGC-7901 cells, SH-SY5Y cells, human heart tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85870-4-RR targets SYNJ2BP in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8130

Product name: Recombinant human ARIP2; SYNJ2BP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-112 aa of BC007704

Sequence: MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGE

Predict reactive species
Full Name synaptojanin 2 binding protein
Calculated Molecular Weight 145 aa, 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC007704
Gene Symbol SYNJ2BP
Gene ID (NCBI) 55333
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP57105
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Activin, a member of the TGF-beta superfamily, plays important roles in reproductive tissues as a stimulator of follicle-stimulating hormone (FSH) secretion and inhibits the proliferation of breast cancer cells. Activin receptor-interacting protein 2 (ARIP2), also known as synaptojanin-2-binding protein (SYNJ2BP), is located in the outer membrane of mitochondria. SYNJ2BP is widely distributed in various human tissues, and has been recently identified in mouse tissues as a regulatory protein of activin signal transduction by interacting with activin type II receptors. SYNJ2BP may be a putative growth-promoting factor involved in breast tumorigenesis and tumor development. A double band of size 15.9 kDa can be detected in Western blot (PMID: 23284606).

Protocols

Product Specific Protocols
IF protocol for SYNJ2BP antibody 85870-4-RRDownload protocol
WB protocol for SYNJ2BP antibody 85870-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...