SYNJ2BP Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of rat kidney using 85870-4-RR (same clone as 85870-4-PBS)

  Rat kidney tissue lysates were subjected to SDS PAGE followed by western blot with 85870-4-RR (ARIP2; SYNJ2BP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85870-4-PBS in a different storage buffer formulation.

• 

  WB analysis using 85870-4-RR (same clone as 85870-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85870-4-RR (ARIP2; SYNJ2BP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85870-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 85870-4-RR (same clone as 85870-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ARIP2; SYNJ2BP antibody (85870-4-RR, Clone: 250205D7 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85870-4-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP02180-1

  Cytometric bead array standard curve of MP02180-1, SYNJ2BP Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85870-4-PBS. Detection antibody: 85870-3-PBS. Standard: Ag8130. Range: 0.781-25 ng/mL.

• 

  Affinity and Kinetic Characterization of 85870-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85870-4-RR against Human SYNJ2BP were performed. The affinity constant is 0.68 nM.

SYNJ2BP Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 85870-4-PBS

Clone No.250205D7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

ARIP2, OMP25, Synaptojanin-2-binding protein

---

Product Information

85870-4-PBS targets SYNJ2BP as part of a matched antibody pair:

MP02180-1: 85870-4-PBS capture and 85870-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8130

  Product name: Recombinant human ARIP2; SYNJ2BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-112 aa of BC007704

  Sequence: MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGE

• Full Name: synaptojanin 2 binding protein
• Calculated Molecular Weight: 145 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC007704
• Gene Symbol: SYNJ2BP
• Gene ID (NCBI): 55333
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P57105
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Activin, a member of the TGF-beta superfamily, plays important roles in reproductive tissues as a stimulator of follicle-stimulating hormone (FSH) secretion and inhibits the proliferation of breast cancer cells. Activin receptor-interacting protein 2 (ARIP2), also known as synaptojanin-2-binding protein (SYNJ2BP), is located in the outer membrane of mitochondria. SYNJ2BP is widely distributed in various human tissues, and has been recently identified in mouse tissues as a regulatory protein of activin signal transduction by interacting with activin type II receptors. SYNJ2BP may be a putative growth-promoting factor involved in breast tumorigenesis and tumor development. A double band of size 15.9 kDa can be detected in Western blot (PMID: 23284606).