SYNJ2BP Recombinant monoclonal antibody, PBS Only (Capture)

SYNJ2BP Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 85870-4-PBS
Clone No.250205D7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

ARIP2, OMP25, Synaptojanin-2-binding protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85870-4-PBS targets SYNJ2BP as part of a matched antibody pair:

MP02180-1: 85870-4-PBS capture and 85870-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8130

Product name: Recombinant human ARIP2; SYNJ2BP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-112 aa of BC007704

Sequence: MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGE

Predict reactive species
Full Name synaptojanin 2 binding protein
Calculated Molecular Weight 145 aa, 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC007704
Gene Symbol SYNJ2BP
Gene ID (NCBI) 55333
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP57105
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Activin, a member of the TGF-beta superfamily, plays important roles in reproductive tissues as a stimulator of follicle-stimulating hormone (FSH) secretion and inhibits the proliferation of breast cancer cells. Activin receptor-interacting protein 2 (ARIP2), also known as synaptojanin-2-binding protein (SYNJ2BP), is located in the outer membrane of mitochondria. SYNJ2BP is widely distributed in various human tissues, and has been recently identified in mouse tissues as a regulatory protein of activin signal transduction by interacting with activin type II receptors. SYNJ2BP may be a putative growth-promoting factor involved in breast tumorigenesis and tumor development. A double band of size 15.9 kDa can be detected in Western blot (PMID: 23284606).

Loading...
||
New chat

Able

正在加载,请稍候...