Mouse ATP1B1 Recombinant monoclonal antibody, PBS Only (Detector)

ATP1B1 Uni-rAb® Recombinant Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85916-1-PBS
Clone No.243093E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test

ATP1B 1, Atp4b, Beta 1 subunit of Na(+) K(+) ATPase, Na, K-ATPase β1, Na+/K+ ATPase beta 1 subunit

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85916-1-PBS targets ATP1B1 as part of a matched antibody pair:

MP02193-3: 85916-2-PBS capture and 85916-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3007

Product name: Recombinant Mouse Atp1b1 protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 63-304 aa of NM_009721.6

Sequence: ELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS

Predict reactive species
Full Name ATPase, Na+/K+ transporting, beta 1 polypeptide
Calculated Molecular Weight35 kDa
Observed Molecular Weight 40-50 kDa
GenBank Accession NumberNM_009721.6
Gene Symbol Atp1b1
Gene ID (NCBI) 11931
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP14094
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ATP1B1 is one of beta subunits of the Na+/K+ ATPase and responsible for formation and structural integrity of the Na+/K+ ATPase. The Na+/K+ ATPase is a plasma membrane pump consisting of alpha, beta, and gamma subunits. At least four of Na+/K+-ATPase beta subunits (β1, β2, β3, β4) have been identified in mammalian cells; the β1-subunit (ATP1B1) is the most ubiquitous. The Na+/K+ ATPase β subunits have multiple N-glycosylation sites. The predicted MW of ATP1B1 is 35 kDa, while it migrates around 40-52 kDa due to the variable glycosylation. (PMID: 10896885, 17714085)

Loading...
||
New chat

Able

正在加载,请稍候...