AK1 Recombinant monoclonal antibody

AK1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 85979-3-RR
Clone No.250557D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

adenylate kinase 1, Adenylate kinase isoenzyme 1, Adenylate monophosphate kinase, AK 1, ATP:AMP phosphotransferase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, HeLa cells, K-562 cells, A172 cells, rat heart tissue, human heart tissue
Positive IF/ICC detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85979-3-RR targets AK1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6890

Product name: Recombinant human AK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-194 aa of BC001116

Sequence: MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Predict reactive species
Full Name adenylate kinase 1
Calculated Molecular Weight 22 kDa
Observed Molecular Weight22 kDa
GenBank Accession NumberBC001116
Gene Symbol AK1
Gene ID (NCBI) 203
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00568
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AK1(Adenylate kinase isoenzyme 1), also known as ATP-AMP transphosphorylase 1. It is located in cytoplasm. This protein is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP 1. Exhibits nucleoside diphosphate kinase activity, catalyzing the production of ATP, CTP, GTP, UTP, dATP, dCTP, dGTP and dTTP from the corresponding diphosphate substrates with either ATP or GTP as phosphate donor 2. Also catalyzes at a very low rate the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP. The molecular weight of AK1 is 22 kDa.

Protocols

Product Specific Protocols
IF protocol for AK1 antibody 85979-3-RRDownload protocol
WB protocol for AK1 antibody 85979-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...