AK1 Recombinant monoclonal antibody, PBS Only (Detector)

AK1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA
Cat No. 85979-3-PBS
Clone No.250557D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

adenylate kinase 1, Adenylate kinase isoenzyme 1, Adenylate monophosphate kinase, AK 1, ATP:AMP phosphotransferase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85979-3-PBS targets AK1 as part of a matched antibody pair:

MP02232-2: 85979-5-PBS capture and 85979-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6890

Product name: Recombinant human AK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-194 aa of BC001116

Sequence: MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Predict reactive species
Full Name adenylate kinase 1
Calculated Molecular Weight 22 kDa
Observed Molecular Weight22 kDa
GenBank Accession NumberBC001116
Gene Symbol AK1
Gene ID (NCBI) 203
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00568
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

AK1(Adenylate kinase isoenzyme 1), also known as ATP-AMP transphosphorylase 1. It is located in cytoplasm. This protein is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP 1. Exhibits nucleoside diphosphate kinase activity, catalyzing the production of ATP, CTP, GTP, UTP, dATP, dCTP, dGTP and dTTP from the corresponding diphosphate substrates with either ATP or GTP as phosphate donor 2. Also catalyzes at a very low rate the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP. The molecular weight of AK1 is 22 kDa.

Loading...
||
New chat Able
正在加载,请稍候...