PRKG1 Recombinant monoclonal antibody, PBS Only (Capture)

PRKG1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85983-1-PBS
Clone No.250348B5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

CGKI, cGK1, cGMP-dependent protein kinase 1, cGMP-dependent protein kinase I, EC:2.7.11.12

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85983-1-PBS targets PRKG1 as part of a matched antibody pair:

MP02943-1: 85983-1-PBS capture and 85983-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16333

Product name: Recombinant human PRKG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-178 aa of BC127090

Sequence: MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPG

Predict reactive species
Full Name protein kinase, cGMP-dependent, type I
Calculated Molecular Weight 686 aa, 78 kDa
Observed Molecular Weight 65-78 kDa
GenBank Accession NumberBC127090
Gene Symbol PRKG1
Gene ID (NCBI) 5592
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13976
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PRKG1(cGMP-dependent protein kinase 1) is also named as cGK1, PRKG1B, PRKGR1A, PRKGR1B and belongs to the cGMP subfamily. It serves as an integral component of second messenger signaling in a number of biological contexts including cell differentiation, memory, and vasodilation (PMID:21893290). Its activity prevents pathological-level nitric oxide-induced apoptosis and promotes DNA synthesis/cell proliferation in vascular smooth muscle cells (PMID:20060325). PRKG1 has 2 isoforms produced by alternative splicing with the molecular weight of 76 kDa and 78 kDa. The autophosphorylation can increase the kinase activity and it can form a monomer with the molecular weight of 65 kDa that is produced by proteolytic cleavage. SDS-PAGE revealed that proteolysis generated two different monomers with molecular masses of 70 and 68 kDa of CGK1-beta(PMID:8702828).

Loading...
||
New chat

Able

正在加载,请稍候...