Rat CD3 epsilon Recombinant monoclonal antibody, PBS Only (Detector)

CD3 epsilon Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Sandwich ELISA, Indirect ELISA
Cat No. 86053-1-PBS
Clone No.242849D3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Sandwich ELISA, Indirect ELISA

CD3e, T-cell surface glycoprotein CD3 epsilon chain

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86053-1-PBS targets CD3 epsilon as part of a matched antibody pair:

MP02251-2: 86053-3-PBS capture and 86053-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1450

Product name: Recombinant Rat CD3 epsilon protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 24-103 aa of NP_001101610.2

Sequence: IEDTVTDDGAQKQYEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLY

Predict reactive species
Full Name CD3 molecule, epsilon polypeptide
Calculated Molecular Weight22kDa
Observed Molecular Weight22 kDa
GenBank Accession NumberNP_001101610.2
Gene Symbol Cd3e
Gene ID (NCBI) 315609
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDA6J423
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD3 is a multimeric protein associated with the T-cell receptor (TCR) to form a complex involved in antigen recognition and signal transduction (PMID: 15885124). CD3 is composed of CD3γ, δ, ε, and ζ chains (PMID: 1826255). It is expressed by thymocytes in a developmentally regulated manner, T cells, and some NK cells (PMID: 3289580). The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction (PMID: 11985657). This antibody was raised against the epsilon chain of rat CD3 molecule.

Loading...
||
New chat

Able

正在加载,请稍候...