Filter: AllWBSandwich ELISA sample testSandwich ELISAIHCIF-P

WB analysis using 86053-1-RR (same clone as 86053-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 86053-1-RR (CD3 epsilon/CD3e antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.
WB analysis of CTLL-2 using 86053-1-RR (same clone as 86053-1-PBS)
CTLL-2 cells were subjected to SDS PAGE followed by western blot with 86053-1-RR (CD3 epsilon/CD3e antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.
Sandwich ELISA sample test of MP02251-2
The mean CD3 epsilon concentration was determined to be 6.3 ng/mL in rat heart tissue extract based on a 6.7 mg/mL extract load and 13.6 ng/mL in rat spleen tissue extract based on a 2.7 mg/mL extract load.
Sandwich ELISA standard curve of MP02251-2
Sandwich ELISA standard curve of MP02251-2, Rat CD3 epsilon Recombinant Matched Antibody Pair - PBS only. 86053-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1450. 86053-1-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.
IHC staining of rat spleen using 86053-1-RR (same clone as 86053-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 86053-1-RR (CD3 epsilon antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.
IHC staining of rat spleen using 86053-1-RR (same clone as 86053-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 86053-1-RR (CD3 epsilon antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.
IHC staining of rat thymus using 86053-1-RR (same clone as 86053-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat thymus tissue slide using 86053-1-RR (CD3 epsilon antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.
IHC staining of rat thymus using 86053-1-RR (same clone as 86053-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat thymus tissue slide using 86053-1-RR (CD3 epsilon antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.
IF Staining of rat thymus using 86053-1-RR (same clone as 86053-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat thymus tissue using CD3 epsilon antibody (86053-1-RR, Clone: 242849D3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat thymus tissue using CD3 epsilon antibody (86053-1-RR, Clone: 242849D3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.
IF Staining of rat thymus using 86053-1-RR (same clone as 86053-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat thymus tissue using CD3 epsilon antibody (86053-1-RR, Clone: 242849D3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat thymus tissue using CD3 epsilon antibody (86053-1-RR, Clone: 242849D3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.
IF Staining of rat spleen using 86053-1-RR (same clone as 86053-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat spleen tissue using CD3 epsilon antibody (86053-1-RR, Clone: 242849D3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat spleen tissue using CD3 epsilon antibody (86053-1-RR, Clone: 242849D3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.

Rat CD3 epsilon Recombinant monoclonal antibody, PBS Only (Detector)

Name: Rat CD3 epsilon Recombinant monoclonal antibody, PBS Only (Detector)
Brand: Proteintech
SKU: 86053-1-PBS

CD3 epsilon Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Sandwich ELISA, Indirect ELISA

Cat No. 86053-1-PBS

Clone No.242849D3

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Sandwich ELISA, Indirect ELISA

Synonyms

CD3e, T-cell surface glycoprotein CD3 epsilon chain

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

86053-1-PBS targets CD3 epsilon as part of a matched antibody pair:

MP02251-2: 86053-3-PBS capture and 86053-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg1450 Product name: Recombinant Rat CD3 epsilon protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-103 aa of NP_001101610.2 Sequence: IEDTVTDDGAQKQYEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLY Predict reactive species
Full Name	CD3 molecule, epsilon polypeptide
Calculated Molecular Weight	22kDa
Observed Molecular Weight	22 kDa
GenBank Accession Number	NP_001101610.2
Gene Symbol	Cd3e
Gene ID (NCBI)	315609
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	A6J423
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CD3 is a multimeric protein associated with the T-cell receptor (TCR) to form a complex involved in antigen recognition and signal transduction (PMID: 15885124). CD3 is composed of CD3γ, δ, ε, and ζ chains (PMID: 1826255). It is expressed by thymocytes in a developmentally regulated manner, T cells, and some NK cells (PMID: 3289580). The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction (PMID: 11985657). This antibody was raised against the epsilon chain of rat CD3 molecule.