CD3 epsilon Recombinant monoclonal antibody

CD3 epsilon Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 86053-1-RR
Clone No.242849D3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, ELISA

CD3e, T-cell surface glycoprotein CD3 epsilon chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat thymus tissue, CTLL-2 cells, mouse thymus tissue, rat spleen tissue
Positive IHC detected inrat spleen tissue, rat thymus tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat thymus tissue, rat spleen tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86053-1-RR targets CD3 epsilon in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1450

Product name: Recombinant Rat CD3 epsilon protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 24-103 aa of NP_001101610.2

Sequence: IEDTVTDDGAQKQYEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLY

Predict reactive species
Full Name CD3 molecule, epsilon polypeptide
Calculated Molecular Weight22kDa
Observed Molecular Weight22 kDa
GenBank Accession NumberNP_001101610.2
Gene Symbol Cd3e
Gene ID (NCBI) 315609
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDA6J423
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD3 is a multimeric protein associated with the T-cell receptor (TCR) to form a complex involved in antigen recognition and signal transduction (PMID: 15885124). CD3 is composed of CD3γ, δ, ε, and ζ chains (PMID: 1826255). It is expressed by thymocytes in a developmentally regulated manner, T cells, and some NK cells (PMID: 3289580). The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction (PMID: 11985657). This antibody was raised against the epsilon chain of rat CD3 molecule.

Protocols

Product Specific Protocols
IF protocol for CD3 epsilon antibody 86053-1-RRDownload protocol
IHC protocol for CD3 epsilon antibody 86053-1-RRDownload protocol
WB protocol for CD3 epsilon antibody 86053-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...