RARG Recombinant monoclonal antibody, PBS Only (Detector)

RARG Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA
Cat No. 86098-1-PBS
Clone No.250399C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

NR1B3, RAR gamma, RARC, RAR-gamma, Retinoic acid receptor gamma

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86098-1-PBS targets RARG as part of a matched antibody pair:

MP02317-1: 86098-2-PBS capture and 86098-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1991

Product name: Recombinant human RARG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC019098

Sequence: MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH

Predict reactive species
Full Name retinoic acid receptor, gamma
Calculated Molecular Weight 454 aa, 50 kDa
Observed Molecular Weight50-60kDa
GenBank Accession NumberBC019098
Gene Symbol RARG
Gene ID (NCBI) 5916
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13631
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Retinoic acid receptors (RARs) are nuclear hormone receptors that act as ligand-dependent transcriptional regulators. In their liganded state, RARs activate transcription, whereas in their nonliganded form, they repress transcription of their target genes. RARs have numerous target genes, which have retinoic response elements in their promoter regions (PMID:17574023). RARG is a member of the retinoid acid receptor (RAR) family, along with RARA, which is known to be involved PML/RARA fusion of acute promyelocytic leukemia, and RARB. and rearrangement that conferred to leukemic cells acute promyelocytic leukemia-like morphologic and immunophenotypic features (PMID:20935257).

Loading...
||
New chat

Able

正在加载,请稍候...