SCPX Recombinant monoclonal antibody, PBS Only (Detector)

SCPX Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 86196-1-PBS
Clone No.250813B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

SCP2, SCP2/SCPx, Acetyl-CoA C-myristoyltransferase, EC:2.3.1.155, EC:2.3.1.16

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86196-1-PBS targets SCPX as part of a matched antibody pair:

MP02291-1: 86196-2-PBS capture and 86196-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5895

Product name: Recombinant human SCPX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-322 aa of BC067108

Sequence: MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGGHSCS

Predict reactive species
Full Name sterol carrier protein 2
Calculated Molecular Weight 59 kDa
Observed Molecular Weight46 kDa, 58 kDa
GenBank Accession NumberBC067108
Gene Symbol SCP2
Gene ID (NCBI) 6342
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP22307
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SCPX protein is a kind of protein related to cholesterol absorption and transport, belonging to SCP-2 gene family. SCPX protein contains an N-terminal thiolase domain and a C-terminal SCP-2 domain. In cells, SCPX protein will be cut into 44-46 kDa thiolase and 13-15 kDa SCP-2 protein. SCPX-2 is a nonspecific lipid transporter, which is involved in the transport and metabolism of intracellular lipids. It is distributed in peroxisome, cytoplasm and nucleus, and may play a role as a transcription factor in nucleus.

Loading...
||
New chat Able
正在加载,请稍候...