Mouse DKK1 Recombinant monoclonal antibody, PBS Only (Capture)

DKK1 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 86207-1-PBS
Clone No.250658B2

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

Dickkopf-1, Dickkopf-related protein 1, DKK 1, Dkk-1, hDkk 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86207-1-PBS targets DKK1 as part of a matched antibody pair:

MP02491-1: 86207-1-PBS capture and 86207-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg4649

Product name: Recombinant Mouse DKK1 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 32-272 aa of NM_010051.3

Sequence: TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH

Predict reactive species
Full Name dickkopf homolog 1 (Xenopus laevis)
Calculated Molecular Weight29kDa
Observed Molecular Weight30-35 kDa
GenBank Accession NumberNM_010051.3
Gene Symbol Dkk1
Gene ID (NCBI) 13380
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO54908
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DKK1, also named a SK and Dickkopf-1, belongs to the dickkopf family. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. SDS-PAGE and Western blot analysis demonstrated that DKK1 is expressed as a 35-kDa doublet protein, which is larger than the deduced molecular mass of 26 kDa. Sometime DKK1 is expressed as a 42- to 50-kDa secreted protein, with little change observed after glycanase treatment.

Loading...
||
New chat

Able

正在加载,请稍候...