FKBP1A Recombinant monoclonal antibody, PBS Only (Capture)

FKBP1A Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA
Cat No. 86249-1-PBS
Clone No.250923G12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

12 kDa FK506-binding protein, Calstabin-1, FK506-binding protein 1A, FKBP 1A, FKBP1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86249-1-PBS targets FKBP1A as part of a matched antibody pair:

MP02313-2: 86249-1-PBS capture and 86249-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0406

Product name: Recombinant human FKBP1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 6-108 aa of BC001925

Sequence: ETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Predict reactive species
Full Name FK506 binding protein 1A, 12kDa
Calculated Molecular Weight 12 kDa
Observed Molecular Weight15 kDa
GenBank Accession NumberBC001925
Gene Symbol FKBP1A
Gene ID (NCBI) 2280
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP62942
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FKBP1A(FK506-binding protein 1A) is also named as FKBP1, FKBP12 and belongs to the FKBP-type PPIase family.It keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Loading...
||
New chat Able
正在加载,请稍候...