FNDC3B Recombinant monoclonal antibody

FNDC3B Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 86272-1-RR
Clone No.250827H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

FAD104, fibronectin type III domain containing 3B, Fibronectin type III domain-containing protein 3B, HCV NS5A-binding protein 37, UNQ2421/PRO4979/PRO34274

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, U-251 cells, 3T3-L1 cells, C6 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86272-1-RR targets FNDC3B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18357

Product name: Recombinant human FNDC3B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 3-370 aa of BC039297

Sequence: VTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQCIQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSSYITREDQYSKPPHKKLKDRQIDRQNRLNSPPSSIYKSSCTTVYNGYGKGHSGGSGGGGSGSGPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPV

Predict reactive species
Full Name fibronectin type III domain containing 3B
Calculated Molecular Weight 1204 aa, 133 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC039297
Gene Symbol FNDC3B
Gene ID (NCBI) 64778
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ53EP0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibronectin type III domain-containing protein 3B(FNDC3B), also named FAD104, belongs to the FNDC3 family. NDC3B is a positive regulator of adipocyte differentiation and is expressed at an early stage of adipocyte differentiation. FNDC3B is an endoplasmic reticulum transmembrane protein with a single transmembrane domain at the C terminus preceded by nine repeated fibronectin type III domains(PMID: 32966780). Due to the ability of the fibronectin type III domain to bind to a variety of proteins, FNDC3B plays a crucial role in cell adhesion, proliferation, and growth signaling. FNDC3B is abnormally expressed in a variety of human cancers, including hepatocellular carcinoma, acute myeloid leukemia, colorectal carcinoma, and cervical carcinoma(PMID: 36275754).

Protocols

Product Specific Protocols
IF protocol for FNDC3B antibody 86272-1-RRDownload protocol
IHC protocol for FNDC3B antibody 86272-1-RRDownload protocol
WB protocol for FNDC3B antibody 86272-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...