FNDC3B Recombinant monoclonal antibody, PBS Only (Detector)

FNDC3B Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 86272-1-PBS
Clone No.250827H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

FAD104, fibronectin type III domain containing 3B, Fibronectin type III domain-containing protein 3B, HCV NS5A-binding protein 37, UNQ2421/PRO4979/PRO34274

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86272-1-PBS targets FNDC3B as part of a matched antibody pair:

MP02305-1: 86272-2-PBS capture and 86272-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18357

Product name: Recombinant human FNDC3B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 3-370 aa of BC039297

Sequence: VTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQCIQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSSYITREDQYSKPPHKKLKDRQIDRQNRLNSPPSSIYKSSCTTVYNGYGKGHSGGSGGGGSGSGPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPV

Predict reactive species
Full Name fibronectin type III domain containing 3B
Calculated Molecular Weight 1204 aa, 133 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC039297
Gene Symbol FNDC3B
Gene ID (NCBI) 64778
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ53EP0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Fibronectin type III domain-containing protein 3B(FNDC3B), also named FAD104, belongs to the FNDC3 family. NDC3B is a positive regulator of adipocyte differentiation and is expressed at an early stage of adipocyte differentiation. FNDC3B is an endoplasmic reticulum transmembrane protein with a single transmembrane domain at the C terminus preceded by nine repeated fibronectin type III domains(PMID: 32966780). Due to the ability of the fibronectin type III domain to bind to a variety of proteins, FNDC3B plays a crucial role in cell adhesion, proliferation, and growth signaling. FNDC3B is abnormally expressed in a variety of human cancers, including hepatocellular carcinoma, acute myeloid leukemia, colorectal carcinoma, and cervical carcinoma(PMID: 36275754).

Loading...
||
New chat

Able

正在加载,请稍候...