Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, PANC-1 cells, A549 cells, NIH/3T3 cells, mouse skeletal muscle tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86274-1-RR targets MCU/CCDC109A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag24733 Product name: Recombinant human CCDC109A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 155-233 aa of BC034235 Sequence: DLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTT Predict reactive species |
| Full Name | coiled-coil domain containing 109A |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC034235 |
| Gene Symbol | CCDC109A |
| Gene ID (NCBI) | 90550 |
| RRID | AB_3744772 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8NE86 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MCU, also known as CCDC109A, is highly conserved across all eukaryotes. The MCU protein is composed of two coiled-coil domains, two TMDs, and a short motif of amino acids between the two TMDs. Knockdown of MCU dramatically reduces mitochondrial Ca2+ uptake in isolated mitochondria, in permeabilized cells and living cells. MCU has 3 isoforms with MW 40,37 and 35 kDa (refer to UniProt). The observed MW of MCU is mainly between 30 to 35 kDa in paper (PMID: 26341627; 28337252).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MCU/CCDC109A antibody 86274-1-RR | Download protocol |
| WB protocol for MCU/CCDC109A antibody 86274-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MCU/CCDC109A Recombinant monoclonal antibody (250879C3), catalog number 86274-1-RR, has 2 citations. One appears in Molecular Biology Reports, studying muscle development, mitochondrial calcium homeostasis, and oxidative phosphorylation via IP3R stabilization in mouse models (WB application). The other is in Materials Today Bio, investigating piezoelectric ZnO-incorporated bioactive glass nanospheres for enhanced odontogenic differentiation and angiogenesis. The cited research fields span mitochondrial biology, muscle development, and tissue engineering/biomaterials.
| Species | Application | Title |
|---|---|---|
Mol Biol Rep DDRGK1 regulates muscle development by maintaining mitochondrial calcium homeostasis and oxidative phosphorylation via stabilizing IP3R.
| ||
Mater Today Bio Piezoelectric ZnO-incorporated bioactive glass nanospheres for enhanced odontogenic differentiation and angiogenesis. |
