Home
Products
Primary Antibodies
Recombinant Antibodies
Surfactant Protein A Recombinant monoclonal antibody (86322-1-RR)

Surfactant Protein A Recombinant monoclonal antibody

Surfactant Protein A Uni-rAb^® Recombinant Antibody for IHC, IF-P, ELISA

Cat No. 86322-1-RR

Clone No.250912G10

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, ELISA

Synonyms

SFTPA1, SFTPA2, 35 kDa pulmonary surfactant-associated protein, COLEC4, Collectin 4

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHCIF-P

IHC staining of mouse lung using 86322-1-RR
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 86322-1-RR (Surfactant Protein A antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 86322-1-RR
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 86322-1-RR (Surfactant Protein A antibody) at dilution of 1:8000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse lung using 86322-1-RR
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using Surfactant Protein A antibody (86322-1-RR, Clone: 250912G10 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of rat lung using 86322-1-RR
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat lung tissue using Surfactant Protein A antibody (86322-1-RR, Clone: 250912G10 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human lung using 86322-1-RR
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung tissue using Surfactant Protein A antibody (86322-1-RR, Clone: 250912G10 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human lung using 86322-1-RR
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung tissue using Surfactant Protein A antibody (86322-1-RR, Clone: 250912G10 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in	mouse lung tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human lung tissue, rat lung tissue, mouse lung tissue

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:4000-1:16000
Immunofluorescence (IF)-P	IF-P : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86322-1-RR targets Surfactant Protein A in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag2417 Product name: Recombinant human SFTPA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 132-248 aa of BC026229 Sequence: MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF Predict reactive species
Full Name	surfactant protein A1
Calculated Molecular Weight	248 aa, 26 kDa
GenBank Accession Number	BC026229
Gene Symbol	Surfactant Protein A
Gene ID (NCBI)	653509
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q8IWL2
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Surfactant protein A (SP-A), is the major protein component of pulmonary surfactant involved in surfactant-related function or structure and in the regulation of inflammatory processes and innate host defens. In humans and primates, SP-A1 (SFTPA1) and SP-A2 (SFTPA2) genes encode SP-A, and these two SP-A genes have high homology (PMID: 34484180, PMID: 19392648). This antibody can recognize both SP-A1 (SFTPA1) and SP-A2 (SFTPA2).