Surfactant Protein A Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Surfactant Protein A Recombinant monoclonal antibody, PBS Only (86322-1-PBS)

Surfactant Protein A Uni-rAb^® Recombinant Antibody for IHC, IF-P, Indirect ELISA

Cat No. 86322-1-PBS

Clone No.250912G10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

SFTPA1, SFTPA2, 35 kDa pulmonary surfactant-associated protein, COLEC4, Collectin 4

• 

  IHC staining of mouse lung using 86322-1-RR (same clone as 86322-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 86322-1-RR (Surfactant Protein A antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86322-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 86322-1-RR (same clone as 86322-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 86322-1-RR (Surfactant Protein A antibody) at dilution of 1:8000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86322-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse lung using 86322-1-RR (same clone as 86322-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using Surfactant Protein A antibody (86322-1-RR, Clone: 250912G10 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86322-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat lung using 86322-1-RR (same clone as 86322-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat lung tissue using Surfactant Protein A antibody (86322-1-RR, Clone: 250912G10 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86322-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human lung using 86322-1-RR (same clone as 86322-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung tissue using Surfactant Protein A antibody (86322-1-RR, Clone: 250912G10 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86322-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human lung using 86322-1-RR (same clone as 86322-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung tissue using Surfactant Protein A antibody (86322-1-RR, Clone: 250912G10 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86322-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86322-1-PBS targets Surfactant Protein A in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2417

  Product name: Recombinant human SFTPA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-248 aa of BC026229

  Sequence: MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

• Full Name: surfactant protein A1
• Calculated Molecular Weight: 248 aa, 26 kDa
• GenBank Accession Number: BC026229
• Gene Symbol: Surfactant Protein A
• Gene ID (NCBI): 653509
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IWL2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Surfactant protein A (SP-A), is the major protein component of pulmonary surfactant involved in surfactant-related function or structure and in the regulation of inflammatory processes and innate host defens. In humans and primates, SP-A1 (SFTPA1) and SP-A2 (SFTPA2) genes encode SP-A, and these two SP-A genes have high homology (PMID: 34484180, PMID: 19392648). This antibody can recognize both SP-A1 (SFTPA1) and SP-A2 (SFTPA2).