Mouse CD39/ENTPD1 Recombinant monoclonal antibody, PBS Only (Detector)

CD39/ENTPD1 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 86327-1-PBS
Clone No.250764B5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

ATP diphosphohydrolase, ATPDase, ATP-DPH, CD39, EC:3.6.1.5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86327-1-PBS targets CD39/ENTPD1 as part of a matched antibody pair:

MP02378-2: 86327-4-PBS capture and 86327-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3483

Product name: recombinant mouse CD39 protein

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 38-478 aa of NM_009848.4

Sequence: TQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYI

Predict reactive species
Full Name ectonucleoside triphosphate diphosphohydrolase 1
Calculated Molecular Weight57 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberNM_009848.4
Gene Symbol Entpd1
Gene ID (NCBI) 12495
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP55772
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ENTPD1 (Ectonucleoside triphosphate diphosphohydrolase 1) is also named CD39, NTPDase 1, and Ecto-ATPDase 1 and belongs to the GDA1/CD39 NTPase family. In the nervous system, it can hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. It is a noncovalent tetrameric protein and detergent inhibition of enzymatic activity is caused by dissociation of ectoapyrase tetramers into monomers(PMID: 9733785 ). And it is a 70- to 100-kDa protein that is heavily N-glycosylated (PMID:7930580). This protein has 6 glycosylation sites and 3 isoforms (58 kDa, 59 kDa, and 34 kDa) produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...