C5a Recombinant monoclonal antibody

C5a Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86463-4-RR

Clone No.251190F4

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C5, Complement C5, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4, complement component 5, CPAMD4

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBAffinity

WB analysis of human plasma using 86463-4-RR
human plasma was subjected to SDS PAGE followed by western blot with 86463-4-RR (Complement C5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity of 86463-4-RR
Biolayer interferometry (BLI) kinetic assays of 86463-4-RR against Human C5a were performed. The affinity constant is 0.251 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

human plasma

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86463-4-RR targets C5a in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg4205 Product name: Recombinant Human Complement C5 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 678-751 aa of NM_001735.3 Sequence: TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR Predict reactive species
Full Name	complement component 5
Calculated Molecular Weight	188 kDa
Observed Molecular Weight	120 kDa
GenBank Accession Number	NM_001735.3
Gene Symbol	C5
Gene ID (NCBI)	727
RRID	AB_3744903
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P01031
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The complement system is an important effector that bridges the innate and adaptive immune systems. The fifth component of complement, C5, is part of the complement cascade and plays an important role in inflammation and cell killing. It consists of disulfide-linked alpha and beta polypeptide chains but can be cleaved into two active peptides (C5a and C5b) by C5 convertases. Mutations and defects in C5 are associated with severe recurrent infections. This antibody specifically recognizes the C5 alpha chain.(PMID: 20010915; PMID: 8011297; PMID: 6554279)