C5a Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• C5a Recombinant monoclonal antibody, PBS Only (86463-4-PBS)

C5a Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86463-4-PBS

Clone No.251190F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C5, Complement C5, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4, complement component 5, CPAMD4

• 

  WB analysis of human plasma using 86463-4-RR (same clone as 86463-4-PBS)

  human plasma was subjected to SDS PAGE followed by western blot with 86463-4-RR (Complement C5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86463-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 86463-4-RR

  Biolayer interferometry (BLI) kinetic assays of 86463-4-RR against Human C5a were performed. The affinity constant is 0.251 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86463-4-PBS targets C5a in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4205

  Product name: Recombinant Human Complement C5 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 678-751 aa of NM_001735.3

  Sequence: TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR

• Full Name: complement component 5
• Calculated Molecular Weight: 188 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: NM_001735.3
• Gene Symbol: C5
• Gene ID (NCBI): 727
• RRID: AB_3744903
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01031
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The complement system is an important effector that bridges the innate and adaptive immune systems. The fifth component of complement, C5, is part of the complement cascade and plays an important role in inflammation and cell killing. It consists of disulfide-linked alpha and beta polypeptide chains but can be cleaved into two active peptides (C5a and C5b) by C5 convertases. Mutations and defects in C5 are associated with severe recurrent infections. This antibody specifically recognizes the C5 alpha chain.(PMID: 20010915; PMID: 8011297; PMID: 6554279)