Home
Products
Primary Antibodies
Recombinant Antibodies
NDUFA1 Recombinant monoclonal antibody (86470-1-RR)

NDUFA1 Recombinant monoclonal antibody

NDUFA1 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 86470-1-RR

Clone No. 251084A5

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CI MWFE, CI-MWFE, Complex I MWFE, Complex I-MWFE, MWFE

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCAffinity

WB analysis using 86470-1-RR
Various lysates were subjected to SDS PAGE followed by western blot with 86470-1-RR (NDUFA1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse heart using 86470-1-RR
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse heart using 86470-1-RR
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat heart using 86470-1-RR
Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat heart using 86470-1-RR
Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 86470-1-RR
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 86470-1-RR
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 86470-1-RR
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat cerebellum using 86470-1-RR
Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 86470-1-RR
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity and Kinetic Characterization of 86470-1-RR
Biolayer interferometry (BLl) kinetic assays of 86470-1-RR against Human NDUFA1 were performed. The affinity constant is 0.588 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NDUFA1 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A-673 cells, SK-BR-3 cells, PANC-1 cells, Ramos cells, HeLa cells, mouse heart tissue, rat heart tissue
Positive IHC detected in	mouse heart tissue, rat heart tissue, mouse cerebellum tissue, rat stomach tissue, human heart tissue, mouse stomach tissue, rat cerebellum tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86470-1-RR targets NDUFA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag7206 Product name: Recombinant human NDUFA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC000266 Sequence: MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID Predict reactive species
Full Name	NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
Calculated Molecular Weight	7.5 kDa
Observed Molecular Weight	8 kDa
GenBank Accession Number	BC000266
Gene Symbol	NDUFA1
Gene ID (NCBI)	4694
RRID	AB_3744907
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O15239
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFA1, also known as NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, it's part of the NADH dehydrogenase (ubiquinone) 1 alpha subcomplex. The NDUFA1 gene encoding the MWFE polypeptide is located on the X chromosome. The NDUFA1 gene product (MWFE protein) is essential for activity of complex I in mammalian mitochondria, and it is predicted to be a membrane protein (PMID: 10200266).