NDUFA1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86470-1-RR (same clone as 86470-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86470-1-RR (NDUFA1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86470-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 86470-1-RR (same clone as 86470-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86470-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 86470-1-RR (same clone as 86470-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86470-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 86470-1-RR (same clone as 86470-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86470-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 86470-1-RR (same clone as 86470-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 86470-1-RR (NDUFA1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86470-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86470-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86470-1-RR against Human NDUFA1 were performed. The affinity constant is 0.588 nM.

NDUFA1 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 86470-1-PBS

Clone No.251084A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CI MWFE, CI-MWFE, Complex I MWFE, Complex I-MWFE, MWFE

---

Product Information

86470-1-PBS targets NDUFA1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7206

  Product name: Recombinant human NDUFA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC000266

  Sequence: MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
• Calculated Molecular Weight: 7.5 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC000266
• Gene Symbol: NDUFA1
• Gene ID (NCBI): 4694
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15239
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NDUFA1, also known as NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, it's part of the NADH dehydrogenase (ubiquinone) 1 alpha subcomplex. The NDUFA1 gene encoding the MWFE polypeptide is located on the X chromosome. The NDUFA1 gene product (MWFE protein) is essential for activity of complex I in mammalian mitochondria, and it is predicted to be a membrane protein (PMID: 10200266).