Product Information
86471-2-PBS targets NKG2C/CD159c as part of a matched antibody pair:
MP02451-1: 86471-2-PBS capture and 86471-1-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1953 Product name: recombinant human NKG2C/CD159c protein Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 94-231 aa of NM_002260.4 Sequence: IPFLEQNNFSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL Predict reactive species |
| Full Name | killer cell lectin-like receptor subfamily C, member 2 |
| Calculated Molecular Weight | 26kDa |
| GenBank Accession Number | NM_002260.4 |
| Gene Symbol | KLRC2 |
| Gene ID (NCBI) | 3822 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P26717 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
