Home
Products
Primary Antibodies
Recombinant Antibodies
SYCP3 Recombinant monoclonal antibody (86648-2-RR)

SYCP3 Recombinant monoclonal antibody

SYCP3 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 86648-2-RR

Clone No.251653A5

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

SCP3, COR1, SCP 3, SCP-3, Synaptonemal complex protein 3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCAffinity

WB analysis using 86648-2-RR
Various lysates were subjected to SDS PAGE followed by western blot with 86648-2-RR (SYCP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 86648-2-RR
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 86648-2-RR (SYCP3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity of 86648-2-RR
Biolayer interferometry (BLI) kinetic assays of 86648-2-RR against Human SYCP3 were performed. The affinity constant is 0.56 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse testis tissue, rat testis tissue
Positive IHC detected in	human testis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:10000
Immunohistochemistry (IHC)	IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86648-2-RR targets SYCP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag32466 Product name: Recombinant human SYCP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 137-236 aa of BC062662 Sequence: DLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF Predict reactive species
Full Name	synaptonemal complex protein 3
Calculated Molecular Weight	236 aa, 28 kDa
Observed Molecular Weight	30 kDa, 33 kDa
GenBank Accession Number	BC062662
Gene Symbol	SYCP3
Gene ID (NCBI)	50511
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q8IZU3
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SYCP3 is an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. SYCP3 is required for centromere pairing during meiosis in male germ cells. SYCP3 is also required for normal meiosis during spermatogenesis and male fertility. Mutations in SYCP3 are associated with azoospermia in males and susceptibility to pregnancy loss in females.