SYCP3 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SYCP3 Recombinant monoclonal antibody, PBS Only (86648-2-PBS)

SYCP3 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 86648-2-PBS

Clone No.251653A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

SCP3, COR1, SCP 3, SCP-3, Synaptonemal complex protein 3

• 

  WB analysis using 86648-2-RR (same clone as 86648-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86648-2-RR (SYCP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86648-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 86648-2-RR (same clone as 86648-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 86648-2-RR (SYCP3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86648-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 86648-2-RR

  Biolayer interferometry (BLI) kinetic assays of 86648-2-RR against Human SYCP3 were performed. The affinity constant is 0.56 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86648-2-PBS targets SYCP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32466

  Product name: Recombinant human SYCP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 137-236 aa of BC062662

  Sequence: DLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF

• Full Name: synaptonemal complex protein 3
• Calculated Molecular Weight: 236 aa, 28 kDa
• Observed Molecular Weight: 30 kDa, 33 kDa
• GenBank Accession Number: BC062662
• Gene Symbol: SYCP3
• Gene ID (NCBI): 50511
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IZU3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SYCP3 is an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. SYCP3 is required for centromere pairing during meiosis in male germ cells. SYCP3 is also required for normal meiosis during spermatogenesis and male fertility. Mutations in SYCP3 are associated with azoospermia in males and susceptibility to pregnancy loss in females.