Use Able AI chat for product recommendations

Nucleoside phosphorylase Recombinant monoclonal antibody, PBS Only (Detector)

Nucleoside phosphorylase Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Cat No. 86651-1-PBS
Clone No.251603E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

PNP, EC:2.4.2.1, Inosine phosphorylase, Inosine-guanosine phosphorylase, PRO1837

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86651-1-PBS targets Nucleoside phosphorylase as part of a matched antibody pair:

MP02719-1: 86651-2-PBS capture and 86651-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12507

Product name: Recombinant human NP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-289 aa of BC106074

Sequence: MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

Predict reactive species
Full Name nucleoside phosphorylase
Calculated Molecular Weight 289 aa, 32 kDa
Observed Molecular Weight32 kDa
GenBank Accession NumberBC106074
Gene Symbol Purine nucleoside phosphorylase
Gene ID (NCBI) 4860
RRIDAB_3745030
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00491
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Purine nucleoside phosphorylases (PNP) is a ubiquitous enzyme of purine metabolism that functions in the salvage pathway, including even those of protozoan parasites, thus enabling the cells to utilize purine bases recovered from metabolized purine ribo- and deoxyribonucleosides to synthesize purine nucleotides (PMID: 11337031, 23332162). PNP deficiency in humans leads to an impairment of T-cell function, usually with no apparent effects on B-cell function. hPNP is widely distributed in various tissues and cells of the human body, with the highest activity in kidney, peripheral lymphocytes and granulocytes (PMID: 38701712).

Loading...
||
New chat

Able

正在加载,请稍候...