Nucleoside phosphorylase Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Nucleoside phosphorylase Recombinant monoclonal antibody (86651-1-RR)

• 

  WB analysis using 86651-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86651-1-RR (Nucleoside phosphorylase antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of NIH/3T3 using 86651-1-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using NP antibody (86651-1-RR, Clone: 251603E11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 86651-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86651-1-RR against Human Nucleoside phosphorylase were performed. The affinity constant is below 1 pM.

Nucleoside phosphorylase Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86651-1-RR

Clone No.251603E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

PNP, EC:2.4.2.1, Inosine phosphorylase, Inosine-guanosine phosphorylase, PRO1837

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, U-937 cells, HL-60 cells, Raji cells, NIH/3T3 cells, rat spleen tissue
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86651-1-RR targets Nucleoside phosphorylase in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12507

  Product name: Recombinant human NP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-289 aa of BC106074

  Sequence: MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

• Full Name: nucleoside phosphorylase
• Calculated Molecular Weight: 289 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC106074
• Gene Symbol: Purine nucleoside phosphorylase
• Gene ID (NCBI): 4860
• RRID: AB_3745030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P00491
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Purine nucleoside phosphorylases (PNP) is a ubiquitous enzyme of purine metabolism that functions in the salvage pathway, including even those of protozoan parasites, thus enabling the cells to utilize purine bases recovered from metabolized purine ribo- and deoxyribonucleosides to synthesize purine nucleotides (PMID: 11337031, 23332162). PNP deficiency in humans leads to an impairment of T-cell function, usually with no apparent effects on B-cell function. hPNP is widely distributed in various tissues and cells of the human body, with the highest activity in kidney, peripheral lymphocytes and granulocytes (PMID: 38701712).