ERCC6L Recombinant monoclonal antibody, PBS Only (Capture)

ERCC6L Uni-rAb® Recombinant Antibody for WB, IP, Sandwich ELISA, Indirect ELISA
Cat No. 86688-1-PBS
Clone No.251669A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Sandwich ELISA, Indirect ELISA

ATP-dependent helicase ERCC6-like, DNA excision repair protein ERCC-6-like, EC:3.6.4.12, PICH, PLK1-interacting checkpoint helicase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86688-1-PBS targets ERCC6L as part of a matched antibody pair:

MP02582-2: 86688-1-PBS capture and 86688-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8223

Product name: Recombinant human ERCC6L protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 110-454 aa of BC008808

Sequence: NAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYACDFNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLINMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDPSGETLSSENKSSWLMTSKPSALAQETSLGAPEPLSGEQLVGSPQDKAAEATNDYETLVKRGKELKECGKIQEALNCLVKALDIKSADPEVMLLTLSLYKQLNNN

Predict reactive species
Full Name excision repair cross-complementing rodent repair deficiency, complementation group 6-like
Calculated Molecular Weight 419 aa, 46 kDa, 141 kDa
Observed Molecular Weight180 kDa
GenBank Accession NumberBC008808
Gene Symbol ERCC6L
Gene ID (NCBI) 54821
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ2NKX8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ERCC6L, also named as Tumor antigen BJ-HCC-15 or PICH, is a 1250 amino acid protein, which contains one helicase ATP-binding domain, one helicase C-terminal domain and two TPR repeats. ERCC6L localizes to kinetochores, inner centromeres and belongs to the SNF2/RAD54 helicase family. ERCC6L as a DNA helicase that acts as an essential component of the spindle assembly checkpoint. The calculated molecular weight of ERCC6L is 140 kDa, but the phosphorylated modification of molecular weight of ERCC6L is about 180kDa.

Loading...
||
New chat

Able

正在加载,请稍候...