Use Able AI chat for product recommendations

KCNIP2 Recombinant monoclonal antibody, PBS Only (Capture)

KCNIP2 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 86696-1-PBS
Clone No.251560C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

A-type potassium channel modulatory protein 2, Cardiac voltage-gated potassium channel modulatory subunit, KChIP2, Kv channel-interacting protein 2, Potassium channel-interacting protein 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86696-1-PBS targets KCNIP2 as part of a matched antibody pair:

MP02717-1: 86696-1-PBS capture and 86696-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14111

Product name: Recombinant human KCNIP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-70 aa of BC034685

Sequence: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCH

Predict reactive species
Full Name Kv channel interacting protein 2
Calculated Molecular Weight 270 aa, 31 kDa
Observed Molecular Weight31-35 kDa
GenBank Accession NumberBC034685
Gene Symbol KCNIP2
Gene ID (NCBI) 30819
RRIDAB_3745060
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NS61
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

KCNIP2 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.

Loading...
||
New chat

Able

正在加载,请稍候...